PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.131240.1
Common NameCsa_1G118890, LOC101214235
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 815aa    MW: 90915.2 Da    PI: 6.5399
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.131240.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-096116481954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  Cucsa.131240.1 611 FEHflHPYPTDTDKHMLATQTGLSRNQVSNWFINARVR 648
                     564459******************************87 PP

2BELL113.11.5e-36468536472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e q+kkakLl +leeV++rYkqy++q+q+v++sFe vagl sa+pY+slAlk++SrhFr+Lk+ai+eq+
  Cucsa.131240.1 468 EYQQKKAKLLYMLEEVCRRYKQYHQQMQMVVNSFESVAGLSSATPYISLALKTVSRHFRSLKNAISEQL 536
                     88*****************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.4E-49375534IPR006563POX domain
PfamPF075261.9E-42380533IPR006563POX domain
PROSITE profilePS5007112.147589652IPR001356Homeobox domain
SMARTSM003891.8E-8592656IPR001356Homeobox domain
CDDcd000863.72E-11592653No hitNo description
SuperFamilySSF466897.7E-17593658IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-27595656IPR009057Homeodomain-like
PfamPF059203.8E-18609648IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 815 aa     Download sequence    Send to blast
MEHSYGFEQH VAQQSRRDKL RVPQNYLRVG EVSRNSDEQL SFHNSEHLGV DLDLVRIQSF  60
NKDAILPHDH LSLLPSEMIN FSRDSNVRDM MLRQELEDPA QCSRQIVTDN SIDYWKSSHP  120
SCDWVVNCGS NSFGGELLNQ EVTDSTVYSL KPTCIGFQTS SSFNNTSNQT FNQDGQKRIG  180
GELHLPQIYQ NTLQDVVTSA SIRTQGLEMT SIVQHNFTEI NQTAACEGSG NELALLPVYR  240
DQPNVLPYDS AGSWTDRTYY NCRSWIGELG SIARKTDEEL RSLMSDSNPQ GLALSLSSNP  300
PSKLPTTQFE ESEELQESIT VLKNSQESKT IKSESLCKLP KPTSIGTKNY GKSFQDVMGV  360
PVNPYRNTGP LGPFTGYATI LKSSKFLKPA QLLLDEFCGS NGHYRFVQPC EVFEKTPGEV  420
GVSTALNAFR NEVVKESSSC ADASTFCGSN ESNVSGVGSI SSDSHQPEYQ QKKAKLLYML  480
EEVCRRYKQY HQQMQMVVNS FESVAGLSSA TPYISLALKT VSRHFRSLKN AISEQLKYLR  540
KVLGEDLSSP SAGTSGSKGD ANSARLKYME QSFQKQKSGI VNIGFLESQN AWRPQRGLPE  600
RAVAILRAWL FEHFLHPYPT DTDKHMLATQ TGLSRNQVSN WFINARVRVW KPMVEEIHML  660
ETKGMEETNN KSHGTRDGSS TLENTAGWTS NEHQPLKNQG VANEMSTHHL QCFGVDSTSG  720
DQNGLGSSAQ PWDQGKQSKL NNGIQSNMER DLTGFMPYQA SASEVGGLGA VSLTLGLRHR  780
VESAHHQQQR HQLQQQDDQL IRHYGSEMIH DFVG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B6e-16598655158Homeobox protein Meis1
4xrs_A6e-16598655158Homeobox protein Meis1
4xrm_B9e-16598656563Homeobox protein Meis2
4xrm_A9e-16598656563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819280.0LN681928.1 Cucumis melo genomic scaffold, anchoredscaffold00004.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004139440.20.0PREDICTED: uncharacterized protein LOC101214235 isoform X1
RefseqXP_011653907.10.0PREDICTED: uncharacterized protein LOC101214235 isoform X1
TrEMBLA0A0A0LSC60.0A0A0A0LSC6_CUCSA; Uncharacterized protein
STRINGVIT_06s0004g02580.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34813257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.13e-81BEL1-like homeodomain 8
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]